Whether you're hosting a fun football or halftime show watch party or looking for the perfect dish to bring to one, we have super flavorful snacks to choose from. Starting with simple nuts and trail mix and progressing to popcorn, chips and dips, french fries, and pretzel sticks, there's something salty and protein-packed for every fan. Go more hearty and filling with quintessential chicken wings, playful Frito pie, and classic hush puppies. Get game day ready with these and more craveable Super Bowl snacks.
01of 50
French Onion Dip
:max_bytes(150000):strip_icc()/French-Onion-Dip-FT-RECIPE1023-d867ad6a9e8046bb8c541873d81dd371.jpg "50 Irresistible Super Bowl Snacks (1)")
Caramelized onions, Worcestershire sauce, and a beef bouillon cube mixed with sour cream and cream cheese make the perfect creamy, tangy dip for game days and parties.
Get the Recipe
02of 50
Suya-Spiced Mixed Nuts
:max_bytes(150000):strip_icc()/Suya-Spiced-Nuts-FT-RECIPE0124-0e5bd71332534ba1871109b9f28f6e63.jpg "50 Irresistible Super Bowl Snacks (2)")
Coat mixed nuts with butter and suya spice for a Nigerian-inspired riff on a popular bar snack that’s hot, sweet, and salty.
Get the Recipe
03of 50
Buffalo and Blue Cheese Popcorn
:max_bytes(150000):strip_icc()/super-bowl-wing-popcorn-FT-BLOG0120-3-2000-f8cf96e3bbe3415e931bc29e101a8b71.jpg "50 Irresistible Super Bowl Snacks (3)")
Get the spicy, buttery, cheesy flavor of Buffalo wings in this quick and easy popcorn recipe perfect for game day parties.
Get the Recipe
04of 50
Spicy Cashew-Lemongrass Snack Mix
:max_bytes(150000):strip_icc()/spicy-cashew-lemongrass-snack-mix-FT-RECIPE0421-d43849a9d85a41a59dd1635b5ea587c6.jpg "50 Irresistible Super Bowl Snacks (4)")
Lime leaves and lemongrass bring citrusy flavor to the buttery cashews, toasted coconut, and crispy garlic. Frying each element individually ensures crunchy components.
Get the Recipe
05of 50
Three-Cheese Queso Nachos
:max_bytes(150000):strip_icc()/favorite-nachos-FT-RECIPE0721-9089f98af3764c3a98684f3619f0da97.jpg "50 Irresistible Super Bowl Snacks (5)")
Layer homemade pickled red onions, jalapeños, chorizo refried beans, and creamy queso made with Monterey Jack, white American, and goat cheese for this colorful loaded snack tray.
Get the Recipe
06of 50
Buffalo Wings
:max_bytes(150000):strip_icc()/Buffalo-Wings-Recipe-FT-BLOG1222-26e07fdb9aec4afe8d4bc39ea331c753.jpg "50 Irresistible Super Bowl Snacks (6)")
There’s no substitute for a classic Buffalo wing when it comes to snacking while watching a game. These wings are fried, then tossed in a buttery hot sauce and served with blue cheese dipping sauce and celery.
Get the Recipe
07of 50
Soft Pretzels
:max_bytes(150000):strip_icc()/FAW-recipes-german-soft-pretzel-sticks-hero-5dc003535d6d448bbd3ae39f8e18cc61.jpg "50 Irresistible Super Bowl Snacks (7)")
2002 F&W Best New Chef Grant Achatz's tender German soft pretzel sticks have a dark golden salt-crusted exterior and chewy centers.
Get the Recipe
08of 50
Cacio e Pepe Potato Chips
:max_bytes(150000):strip_icc()/Cacio-e-Pepe-Potato-Chips-FT-RECIPE1023-85b8c8664b7e4c079733d015cbb0b0b4.jpg "50 Irresistible Super Bowl Snacks (8)")
A little cheese and pepper turn plain kettle-cooked potato chips into a standout snack.
Get the Recipe
09of 50
Sweet Potato Oven Fries
:max_bytes(150000):strip_icc()/Sweet-Potato-Oven-Fries-FT-RECIPE0323-61dd2fefa241483f918d2b4e849e94f9.jpg "50 Irresistible Super Bowl Snacks (9)")
You can play around with the seasonings for these fries very easily. Sprinkle pimentón (smoked paprika) or Urfa chili powder for a little smokiness to balance the sweet.
Get the Recipe
10of 50
Adobo Chicken Wings
:max_bytes(150000):strip_icc()/Adobo-Chicken-Wings-FT-RECIPE0722-16280904bb054deca32db1d3a7dd4fe0.jpg "50 Irresistible Super Bowl Snacks (10)")
This modern take on classic Filipino chicken adobo brings its umami-rich flavor to oven-roasted chicken wings.
Get the Recipe
11of 50
Frito Pie
:max_bytes(150000):strip_icc()/Frito-Pie-FT-RECIPE0822-2000-a59c8e5e0d754194bc8cd6366c3d0ed3.jpg "50 Irresistible Super Bowl Snacks (11)")
Frito Pie is a glorious mess of corn chips, chili, cheese and other toppings piled together — often right in the chip bag.
Get the Recipe
12of 50
Nacho Snack Dinner with Sweet Potato Queso
:max_bytes(150000):strip_icc()/fwcooks-nacho-snack-dinner-with-sweet-potato-queso-recipe2019_109-1da64489e06f49ecbada050d84ea4ae4.jpg "50 Irresistible Super Bowl Snacks (12)")
Try recipe developer Ann Taylor Pittman's mashup of a cheese board (but with less cheese), a charcuterie board (but with less meat), and a crudité platter (but with more heft), built around a central dip or spread, with lots of fresh vegetables.
Get the Recipe
13of 50
Vegan Pimiento Cheese
:max_bytes(150000):strip_icc()/vegan-pimento-cheese-FT-RECIPE0422-c25b1ce5e84a425c824c57581d1b1015.jpg "50 Irresistible Super Bowl Snacks (13)")
Pimiento cheese is an iconic snack in the South, and beloved all over. For this vegan version, sweet pimientos stud a creamy and savory base made with extra-firm tofu. The pickle brine and apple cider vinegar lend an acidic brightness to the mixture, while nutritional yeast and miso provide deep umami.
Get the Recipe
14of 50
Hush Puppies
:max_bytes(150000):strip_icc()/Hush-Puppies-with-Yuzu-KoshoHoney-Butter-FT-RECIPE1023-31414033a8ee40d9adca8ae61675c48a.jpg "50 Irresistible Super Bowl Snacks (14)")
Serve these fluffy hush puppies with a lacy, crisp crust alongside an irresistible sweet and spicyyuzu kosho–honey butter.
Get the Recipe
15of 50
Barbecue-Spiced Potato Chips
:max_bytes(150000):strip_icc()/barbecue-spiced-potato-chips-FT-RECIPE0620-9a3352ca5d734a8f83ec753353d0df1a.jpg "50 Irresistible Super Bowl Snacks (15)")
Ultra crispy homemade chips are within your reach, and it just requires a simple soak in vinegar water.
Get the Recipe
16of 50
Caramelized Five-Onion Dip
:max_bytes(150000):strip_icc()/caramelized-five-onion-dip-FT-RECIPE1220-65c82291312742a4be674f6ce7bdba35.jpg "50 Irresistible Super Bowl Snacks (16)")
Upgrade classic caramelized onion dip with layers of flavor from shallots, scallions, and sweet, yellow, and red onions. Yellow and red onions give it bite, while Vidalia onion and shallots lend a pleasant sweetness.
Get the Recipe
17of 50
Sweet Potato Tater Tots
:max_bytes(150000):strip_icc()/Sweet-Potato-Tater-Tots-FT-RECIPE0823-e64aa409d03440fe89c47b401406d0b2.jpg "50 Irresistible Super Bowl Snacks (17)")
Dip this crispy, gently spiced snack in mustard or aïoli. Be sure to scale the recipe up for a crowd.
Get the Recipe
18of 50
Ham and Cheese Sliders
:max_bytes(150000):strip_icc()/Baked-Ham-Cheese-Sliders-FT-RECIPE1023-b91bae2b6b8249d284438b5a1b4f8cd1.jpg "50 Irresistible Super Bowl Snacks (18)")
Butter, Dijon mustard, and melty Swiss cheese make these 30-minute sliders an easy win.
Get the Recipe
19of 50
Loaded Pita Nachos with Lentil Chili and Feta Queso
:max_bytes(150000):strip_icc()/Loaded-Pita-Nachos-With-Lentil-Chili-And-Feta-Queso-FT-Recipe-0821-fcb55035186745f68c98daf102400094.jpg "50 Irresistible Super Bowl Snacks (19)")
Serve plant-based nachos, by drizzling pita chips with a feta queso and then layering lentil chili, harissa-spiked pickled cabbage, and a dollop of creamy labneh. Make the chips, queso, and cabbage ahead of time and use store-bought pita chips to keep this easy.
Get the Recipe
20of 50
Fried Boudin Balls with Creole Mustard Dipping Sauce
:max_bytes(150000):strip_icc()/Fried-Boudin-Balls-with-Creole-Mustard-Dipping-Sauce-FT-RECIPE0822-2000-8c925eb2dbf64a14a4ee2a38857d29df.jpg "50 Irresistible Super Bowl Snacks (20)")
These boudin balls boast pork, rice, liver, and seasonings. They are fried for a crispy exterior and a light, almost creamy interior.
Get the Recipe
21of 50
Quesadizzas
:max_bytes(150000):strip_icc()/quesadizzas-FT-RECIPE0319_0-2733c785eeec4eb192c9df99b8ef10ad.jpg "50 Irresistible Super Bowl Snacks (21)")
This mash-up of a quesadilla and pizza gets a spicy kick from jalapeño-laced pepper jack cheese and garlicky Portuguese linguiça.
Get the Recipe
22of 50
Tuna-Avocado Ceviche with Salsa Macha
:max_bytes(150000):strip_icc()/fwcooks_tunacevichewithsalsamachaftrecipe201963_1-27d80e73e9cd472e8a29b2ba7e9b73a3.jpg "50 Irresistible Super Bowl Snacks (22)")
Salsa machatastes amazing on pretty much anything. Add a couple spoonfuls to cubed raw fish to transform an everyday ceviche into an extraordinary snack. Serve like poke or with tostadas.
Get the Recipe
23of 50
Pepperoni Rolls with Garlic-Anchovy Marinara
:max_bytes(150000):strip_icc()/Pepperoni-Rolls-with-Garlic-Anchovy-Marinara-FT-RECIPE0622-2000-46007dc4e30e4d30b14536fb9942e4da.jpg "50 Irresistible Super Bowl Snacks (23)")
Spicy pepperoni and provolone cheese are baked inside a soft yeasted bread roll for this irresistible snack.
Get the Recipe
24of 50
Classic Cheese Ball with Spiced Pecans
:max_bytes(150000):strip_icc()/classic-cheeseball-FT-RECIPE0920-e395f733cc494ac99daffe97347f1d51.jpg "50 Irresistible Super Bowl Snacks (24)")
This iconic Southern party starter is a classic for good reason. It’s easy to put together, looks polished on a platter, and boasts an irresistible savory flavor.
Get the Recipe
25of 50
Black Pepper Jerky
:max_bytes(150000):strip_icc()/black-pepper-jerky-Hero_01_02-FT-RECIPE1222-67a121003f994f4b9d5662d4095c2cd0.jpg "50 Irresistible Super Bowl Snacks (25)")
This classic jerky gets a double dose of peppery flavor from both cracked peppercorns in the marinade and coarsely ground peppercorns on top.
Get the Recipe
26of 50
Chicken Samosas
:max_bytes(150000):strip_icc()/Chicken-Samosa-FT-RECIPE1123-faf81f431f6c4df299a66b2175490f06.jpg "50 Irresistible Super Bowl Snacks (26)")
Tender, flaky dough is folded into triangular pockets around a savory chicken filling and fried until golden and crisp in this easy-to-love chicken samosa.
Get the Recipe
27of 50
Chile Crisp-Glazed Bacon Bites
:max_bytes(150000):strip_icc()/chile-crisp-glazed-bacon-bites-FT-RECIPE1220-130178ba049642f6b2a4c19881d8754f.jpg "50 Irresistible Super Bowl Snacks (27)")
For this party snack, meaty bites of slow-roasted slab bacon are tossed with a homemade chile crisp that's studded with freshly toasted chunks of dried chiles, fresh ginger, and garlic.
Get the Recipe
28of 50
Flaky Andouille and Callaloo Hand Pies with Red Pepper Sambal
:max_bytes(150000):strip_icc()/Flaky-Andouille-and-Callaloo-Hand-Pies-FT-RECIPE0822-2430aa6a33b84ebe9cac552e4358e051.jpg "50 Irresistible Super Bowl Snacks (28)")
Marcus Samuelsson's delicious hand pies are filled with callaloo and andouille, but you can fill them with anything you have on hand, including sausage, fish, ham, vegetables, or even fresh crab.
Get the Recipe
29of 50
Tropical Snack Mix
:max_bytes(150000):strip_icc()/tiki-snack-mix-XL-RECIPE0918-1ef3a52d59a34acaae2d45eb057d8236.jpg "50 Irresistible Super Bowl Snacks (29)")
This irresistible mix of soy-and-honey-glazed peanuts, bacon, and chewy pineapple is a wonderful complement to just about any drink.
Get the Recipe
30of 50
Nachos in a Bag
:max_bytes(150000):strip_icc()/kristen-kish-buenos-naches-XL-SS0317-6ebfa767fd2c44aaa7c21632028ea811.jpg "50 Irresistible Super Bowl Snacks (30)")
Top Chef host Kristen Kish fills individual bags of chips with cheddar, taco meat, sour cream, chopped onion, pickled jalapeño, canned black olives, tomatoes, and more.
Get the Recipe
31of 50
Buffalo Chicken Dip
:max_bytes(150000):strip_icc()/buffalo-chicken-dip-XL-RECIPE2016_0-f892cad7b764421787fd8401f9599dc1.jpg "50 Irresistible Super Bowl Snacks (31)")
This crowd-pleasing dip from F&W’s Justin Chapple has all the punchy flavors of Buffalo chicken wings with a creamy texture from cream cheese and sour cream.
Get the Recipe
32of 50
French Fries with Bulgogi and Caramelized Kimchi
:max_bytes(150000):strip_icc()/201205-xl-french-fries-with-bulgogi-and-caramelized-kimchi-f6d0379438ef4834a0c5f6c4bf8ee87b.jpg "50 Irresistible Super Bowl Snacks (32)")
Top hot french fries with caramelized kimchi, grilled Korean-style beef, and a mayonnaise spiked with Sriracha.
Get the Recipe
33of 50
Hogs in a Blanket
:max_bytes(150000):strip_icc()/201212-xl-hogs-in-a-blanket-4e050bd807434eef849acbda1e2629e9.jpg "50 Irresistible Super Bowl Snacks (33)")
This fun take on pigs in a blanket swaps spicy andouille sausage for the hot dogs, with sweet mustard chutney as a condiment.
Get the Recipe
34of 50
Bacon Candy
:max_bytes(150000):strip_icc()/HD-201212-r-bacon-candy-e722af7080b04ce9840db7fa581a758e.jpg "50 Irresistible Super Bowl Snacks (34)")
Crispy, sweet, and salty, this three-ingredient snack is the ultimate co*cktail party hors d'oeuvre.
Get the Recipe
35of 50
Best Nachos of All Time
:max_bytes(150000):strip_icc()/andrew-zimmern-buenos-nachos-XL-SS0317-8797af448aab457087a0556743baacb5.jpg "50 Irresistible Super Bowl Snacks (35)")
Chef and TV host Andrew Zimmern assures us, "These super-sophisticated nachos are built with several components, all made from scratch and delicious on their own. When served together, they will blow your mind."
Get the Recipe
36of 50
Pigs in a Blanket
:max_bytes(150000):strip_icc()/pigs-in-blanket-black-pepper-pastry-xl-recipe0317_0-ba626417cd524f44bc53af02fbe1f116.jpg "50 Irresistible Super Bowl Snacks (36)")
Use frozen packaged puff pastry to make this an easy snack to pull together, and brush the puff pastry with a glaze made with butter, brown sugar, honey, and Dijon mustard, to upgrade the nostalgic standby.
Get the Recipe
37of 50
Crudités and Fermented Soybean Dip
:max_bytes(150000):strip_icc()/crudites-and-fermented-soy-bean-dip-xl-RECIPE0718-1fd42c7da0ac46c9996a67381fa2e685.jpg "50 Irresistible Super Bowl Snacks (37)")
Pair just-picked vegetables with a thick, tangy soy dip to show off whatever fresh vegetables you can get your hands on.
Get the Recipe
38of 50
Sugar and Spice Nuts
:max_bytes(150000):strip_icc()/portable-new-years-party-dishes-sugar-and-spice-nuts-fwx-902d491975024584a3db362d8bd94b1b.jpg "50 Irresistible Super Bowl Snacks (38)")
These spicy nuts are flavored with a simple blend of sugar, salt, cinnamon, and cayenne, along with a full tablespoon of chile powder.
Get the Recipe
39of 50
Holy Guacamole Nachos
:max_bytes(150000):strip_icc()/colin-hanks-buenos-nachos-XL-SS0317-3a07e918c38044d39b41f7e0d1b2ff4f.jpg "50 Irresistible Super Bowl Snacks (39)")
Top tortilla chips with a deconstructed guacamole recipe: tomato, red onion, avocado, cilantro, lime, and pureed chipotle peppers in adobo, which lend a smokiness to the snack.
Get the Recipe
40of 50
Sticky Baked Chicken Wings
:max_bytes(150000):strip_icc()/sticky-baked-chicken-wings-xl-recipe0117-83d751cf8a7944ab8f33154f68f14e0d.jpg "50 Irresistible Super Bowl Snacks (40)")
Toss chicken wings in a spicy glaze made with gochujang, the Korean red pepper paste, to bake in the oven instead of deep-frying.
Get the Recipe
41of 50
Buffalo Chicken Calzones
:max_bytes(150000):strip_icc()/buffalo-chicken-calzones-XL-RECIPE1017-1212699d95b2430481887ab202309f28.jpg "50 Irresistible Super Bowl Snacks (41)")
Toss rotisserie chicken with a buttery Buffalo sauce, then bake it into a calzone with Monterey Jack cheese for a hearty handheld snack in 45 minutes.
Get the Recipe
42of 50
Philly Cheesesteak Queso
:max_bytes(150000):strip_icc()/philly-cheesesteak-queso-XL-RECIPE2018-2ed2200b301a4d0f81487bfe6943977c.jpg "50 Irresistible Super Bowl Snacks (42)")
Justin Chapple combines Tex-Mex queso and Philly cheesesteak flavors for this crowd-pleasing dip with provolone and white American cheeses, sautéed peppers, onions, and thinly sliced rib-eye steak.
Get the Recipe
43of 50
Taco Dip
:max_bytes(150000):strip_icc()/taco-dip-XL-RECIPE2016-d5fd9bebcd8a4eafaa94891b100e76d3.jpg "50 Irresistible Super Bowl Snacks (43)")
Justin Chapple's riff on seven-layer dip starts with a layer of super–flavorful ground beef that’s spiced with homemade taco seasoning.
Get the Recipe
44of 50
Bacon-Wrapped Cherry Peppers
:max_bytes(150000):strip_icc()/201305-xl-bacon-wrapped-cherry-peppers-2000-5b5eed571368487c81fb60d51a2aa94e.jpg "50 Irresistible Super Bowl Snacks (44)")
These genius hors d'oeuvres from 2005 F&W Best New Chef Colby Garrelts call for just three ingredients and can be made ahead of time, so it's great for parties.
Get the Recipe
45of 50
Chips in Salsa
:max_bytes(150000):strip_icc()/2012-co*cktails-xl-chips-in-salsa-2000-6f6e3dfb7fce4784820143b2c606564f.jpg "50 Irresistible Super Bowl Snacks (45)")
In this best possible version of flavored tortilla chips, 1995 F&W Best New Chef Traci Des Jardins tosses the just-fried chips with homemade salsa, then sprinkles them with a little Mexican cotija cheese.
Get the Recipe
46of 50
Chunky Guacamole with Cumin
:max_bytes(150000):strip_icc()/chunky-guacamole-with-cumin-xl-r-200309-17ac80ad5cbd4c45ac58d9f7995bf3c0.jpg "50 Irresistible Super Bowl Snacks (46)")
This guac's a winner because of its subtle tartness, nicely balanced heat, and creamy-chunky texture.
Get the Recipe
47of 50
Mac and Cheese Bites
:max_bytes(150000):strip_icc()/fried-mac-and-cheese-bites-XL-RECIPE2016-16e7ee37ea024ce8913b1827c06ca28c.jpg "50 Irresistible Super Bowl Snacks (47)")
Use store-bought boxes of your favorite mac and cheese to make these crispy bites.
Get the Recipe
48of 50
Easy Hummus with Tahini
:max_bytes(150000):strip_icc()/201005-r-xl-easy-hummus-with-tahini-2000-dfeef8c489f349e7af33c2b4271d91c4.jpg "50 Irresistible Super Bowl Snacks (48)")
Add nutty flavorto your vegetables of choice with recipe developer Grace Parisi's sublime hummus.
Get the Recipe
49of 50
Queso Fundido
:max_bytes(150000):strip_icc()/200606-xl-baylesss-queso-fundido-al-tequila-ba2a5aa53a914412a5e20704ceab6776.jpg "50 Irresistible Super Bowl Snacks (49)")
1988 F&W Best New Chef Rick Bayless' quick dip of melted cheese is flavored with tomatoes, chiles, onions, and a hint of tequila.
Get the Recipe
50of 50
Roasted Edamame Snacks
:max_bytes(150000):strip_icc()/201301-r-xl-roasted-edamame-snacks-2000-92219320c4b14a2e9afcef1fecccff60.jpg "50 Irresistible Super Bowl Snacks (50)")
Edamame roasted in a spiced soy sauce mixture makes a fantastic snack and is also incredibly easy to make.
Get the Recipe
